PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.YC6YV
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family B3
Protein Properties Length: 324aa    MW: 37658.4 Da    PI: 10.3539
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.YC6YVgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3474.6e-1520109298
                  EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  fk+ ++  +l  g l +p kf ++hg++ +++  + l+ ++g +W++    ++++++++++kGWkeF+    L+ g  + Fk++g+s+   +v +f+
  Araip.YC6YV  20 FKIILR-KSLDDGYLKIPTKFSRKHGNNMPNP--VYLKPPDGTQWKIDW--TNNGDEILFQKGWKEFATFYTLDNGHLLWFKYNGTSNI--KVNIFD 109
                  555544.4455667***********9997776..***************..*******************************9986555..888886 PP

2B344.52.8e-142443221799
                  E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  +lp  f++ + +++++       +   ++W  +liy  ++++ +++ +W+ Fvk+n++k+gD+++F+l++r++ el+v+++r+
  Araip.YC6YV 244 SLPVCFFRMYFENTKQ---YATLHVGKKQWHATLIYYPYKKSAIIS-NWRLFVKENNIKAGDVCIFELINRQDPELKVHICRS 322
                  7888888888656444...44455677*********9999998887.************************9*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.60518111IPR003340B3 DNA binding domain
CDDcd100171.47E-1018109No hitNo description
SuperFamilySSF1019363.14E-1918118IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-1919111IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.7E-1119111IPR003340B3 DNA binding domain
PfamPF023623.1E-1220109IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.8E-18221322IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-16222322IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.5E-8229323IPR003340B3 DNA binding domain
PfamPF023629.0E-12244322IPR003340B3 DNA binding domain
CDDcd100173.87E-11244321No hitNo description
PROSITE profilePS5086310.066268323IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MASSSFQKNK HSLFTVIRFF KIILRKSLDD GYLKIPTKFS RKHGNNMPNP VYLKPPDGTQ  60
WKIDWTNNGD EILFQKGWKE FATFYTLDNG HLLWFKYNGT SNIKVNIFDM SGLEIEYTSN  120
GRIGDDNLVE TLEAPPPRRG RGRPKKKVIA EPKQSCPSTS KKMKRAIKTK DMDKSPNTQN  180
LKQHVKFKIE EDGQSEETTD IKQPIVQCAR PDIDVIREAR KFKSKNPSFV IKIRQKHQAG  240
SPASLPVCFF RMYFENTKQY ATLHVGKKQW HATLIYYPYK KSAIISNWRL FVKENNIKAG  300
DVCIFELINR QDPELKVHIC RSHD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016179824.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-28B3 family protein